PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29785.m000932
Common NameRCOM_0783660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB
Protein Properties Length: 478aa    MW: 53201.1 Da    PI: 4.9871
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29785.m000932genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-183380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
    29785.m000932 33 KGPWTSAEDAILVDYVTKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 80
                     79******************************************9986 PP

2Myb_DNA-binding49.21.2e-1586129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ +++++++++G++ W++ a++++ gRt++++k++w++
    29785.m000932  86 KGAFTAQEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 129
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2762880IPR017930Myb domain
SuperFamilySSF466896.36E-3030127IPR009057Homeodomain-like
SMARTSM007171.1E-143282IPR001005SANT/Myb domain
PfamPF002493.2E-153380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-243487IPR009057Homeodomain-like
CDDcd001675.20E-113580No hitNo description
PROSITE profilePS5129425.10681135IPR017930Myb domain
SMARTSM007171.4E-1585133IPR001005SANT/Myb domain
PfamPF002491.5E-1486129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2588133IPR009057Homeodomain-like
CDDcd001673.10E-1188129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MSRMTNGGED HKRSKCRQDS QTIEEAINSP LKKGPWTSAE DAILVDYVTK HGEGNWNAVQ  60
KHSGLSRCGK SCRLRWANHL RPDLKKGAFT AQEERRIIEL HAKMGNKWAR MAAELPGRTD  120
NEIKNYWNTR IKRLQRAGLP IYPPEVCLQL FNGSHESQNL GTPQTTDTHS SDLIQTGHYE  180
IPEVQFQNFE FSRGLLSYPP NILEIPMTSM PKQGVHPSDS DGFVFPTLTP AKRLRESDSE  240
FPVLDGGSDG LPAYIQEPFG LSSSYDSHTN YYGQQLLAVP PGSHALLNDN SSSSEPLCGA  300
MKLELPSLQY SETQQDSWER PTSPLPSLES VDTLIQSPPT ELTQSHCFSP RDNGTLEALL  360
YGSQSLKNSK KTLDHQFSVS SVAPSDIGDC PSNTGETEKE AHGDPNSPLG IDLKPEIANE  420
VLNPFLEEKE ASNHIDYTRP DLLLGSCWFG FSGGHVKDEY FQNEDVQVPF DDEVNIKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-302413318126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577302.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC26e-96GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLB9SB390.0B9SB39_RICCO; Myb81, putative
STRINGPOPTR_0009s02380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-100myb domain protein 33